| Edit |   |
|---|
| Antigenic Specificity | Integrin beta 5 |
|---|
| Clone | 1D8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. It has been used for ELISA and WB. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Integrin beta 5 Antibody (1D8) from Novus Biologicals is a mouse monoclonal antibody to Integrin beta 5. This antibody reacts with human. The Integrin beta 5 Antibody (1D8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ITGB5 (NP_002204 421 a.a. - 516 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA |
|---|
| Other Names | FLJ26658, integrin beta-5, integrin, beta 5 |
|---|
| Gene, Accession # | ITGB5, Gene ID: 3693, Accession: NP_002204, SwissProt: NP_002204 |
|---|
| Catalog # | H00003693-M02 |
|---|
| Price | |
|---|
| Order / More Info | Integrin beta 5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|