| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KCC3/SLC12A6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KCC3/SLC12A6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCC3/SLC12A6. This antibody reacts with human. The KCC3/SLC12A6 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human KCC3/SLC12A6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RVRFSSRESVPETSRSEPMSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDE |
|---|
| Other Names | ACCPN, agenesis of corpus callosum and peripheral neuropathy (Andermann syndrome), DKFZp434D2135, EC 1.2.4.1, EC 6.1.1.3, Electroneutral potassium-chloride cotransporter 3, KCC3A, KCC3B, KCC3potassium chloride cotransporter 3, K-Cl cotransporter 3, potassium chloride cotransporter KCC3a-S3, potassium-chloride transporter-3a, potassium-chloride transporter-3b, solute carrier family 12 (potassium/chloride transporters), member 6, solute carrier family 12 member 6 |
|---|
| Gene, Accession # | SLC12A6, Gene ID: 9990 |
|---|
| Catalog # | NBP1-89282 |
|---|
| Price | |
|---|
| Order / More Info | KCC3/SLC12A6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25110711 |
|---|
| 产品资料 |
|
|