| 产品详情 |
| Edit |   |
| Antigenic Specificity | PSMC6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PSMC6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PSMC6. This antibody reacts with human. The PSMC6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat PSMC6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLT IMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIR |
| Other Names | 26S protease regulatory subunit 10B, 26S protease regulatory subunit S10B, 26S proteasome AAA-ATPase subunit RPT4, CADP44, conserved ATPase domain protein 44, MGC12520, p42, P44, proteasome (prosome, macropain) 26S subunit, ATPase, 6, Proteasome 26S subunit ATPase 6, Proteasome subunit p42, SUG2 |
| Gene, Accession # | PSMC6, Gene ID: 5706 |
| Catalog # | NBP2-13822 |
| Price | |
| Order / More Info | PSMC6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|