| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PSMC3IP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PSMC3IP Antibody from Novus Biologicals is a rabbit polyclonal antibody to PSMC3IP. This antibody reacts with human, mouse, rat. The PSMC3IP Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat PSMC3IP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPD |
|---|
| Other Names | DBD-interacting, GT198, GT198 alternative, homologous-pairing protein 2 homolog, HOP2, HUMGT198A, Nuclear receptor coactivator GT198, Proteasome 26S ATPase subunit 3-interacting protein, PSMC3 interacting protein, Tat-binding protein 1-interacting protein, TBP-1 interacting protein, TBP-1-interacting protein, TBPIPPSMC3-interacting protein |
|---|
| Gene, Accession # | PSMC3IP, Gene ID: 29893 |
|---|
| Catalog # | NBP1-92301 |
|---|
| Price | |
|---|
| Order / More Info | PSMC3IP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25259924, 25590583, 27760120 |
|---|
| 产品资料 |
|
|