| 产品详情 |
| Edit |   |
| Antigenic Specificity | PSMD11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PSMD11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PSMD11. This antibody reacts with human. The PSMD11 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PSMD11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKY |
| Other Names | MGC3844,26S proteasome regulatory subunit RPN6, p44.5,26S proteasome regulatory subunit 9, proteasome (prosome, macropain) 26S subunit, non-ATPase, 11,26S proteasome regulatory subunit p44.5, Rpn6,26S proteasome regulatory subunit S9, S9,26S proteasome non-ATPase regulatory subunit 11 |
| Gene, Accession # | PSMD11, Gene ID: 5717 |
| Catalog # | NBP2-55793 |
| Price | |
| Order / More Info | PSMD11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|