| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LIM Kinase 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC, WB reported in scientific literature (PMID: 25237832). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LIM Kinase 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LIM Kinase 1. This antibody reacts with human. The LIM Kinase 1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LIM Kinase 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHV |
|---|
| Other Names | EC 2.7.11.1, LIM domain kinase 1, LIM motif-containing protein kinase, LIMKLIMK-1 |
|---|
| Gene, Accession # | LIMK1, Gene ID: 3984 |
|---|
| Catalog # | NBP1-87721 |
|---|
| Price | |
|---|
| Order / More Info | LIM Kinase 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22253135, 25237832 |
|---|
| 产品资料 |
|
|