| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GBGT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GBGT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GBGT1. This antibody reacts with human. The GBGT1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GBGT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPS LKLIRFSTLDKDISCLR |
|---|
| Other Names | A3GALNT, EC 2.4.1.-, Forssman glycolipid synthase-like protein, Forssman glycolipid synthetase (FS), Forssman synthetase, FSUNQ2513, globoside alpha-1,3-N-acetylgalactosaminyltransferase 1, MGC44848, UDP-GalNAc |
|---|
| Gene, Accession # | GBGT1, Gene ID: 26301 |
|---|
| Catalog # | NBP2-14040 |
|---|
| Price | |
|---|
| Order / More Info | GBGT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|