| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | G3BP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. WB reported in scientific literature (PMID: 27513819). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The G3BP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to G3BP1. This antibody reacts with human, mouse, rat. The G3BP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human, mouse, rat G3BP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAP |
|---|
| Other Names | ATP-dependent DNA helicase VIII, EC 3.6.1, EC 3.6.4.12, EC 3.6.4.13, G3BP-1, G3BPRas-GTPase-activating protein SH3-domain-binding protein, GAP binding protein, GAP SH3 domain-binding protein 1, GTPase activating protein (SH3 domain) binding protein 1, hDH VIII, HDH-VIII, MGC111040, ras GTPase-activating protein-binding protein 1, RasGAP-associated endoribonuclease G3BP |
|---|
| Gene, Accession # | G3BP1, Gene ID: 10146 |
|---|
| Catalog # | NBP1-83404 |
|---|
| Price | |
|---|
| Order / More Info | G3BP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27513819 |
|---|
| 产品资料 |
|
|