| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | G3BP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC-P reported in scientific literature (PMID: 26285647). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. Other verified by a customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The G3BP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to G3BP2. This antibody reacts with human, mouse, rat. The G3BP2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat G3BP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS |
|---|
| Other Names | G3BP-2, GAP SH3 domain-binding protein 2, GTPase activating protein (SH3 domain) binding protein 2, KIAA0660, ras GTPase-activating protein-binding protein 2, Ras-GTPase activating protein SH3 domain-binding protein 2 |
|---|
| Gene, Accession # | G3BP2, Gene ID: 9908 |
|---|
| Catalog # | NBP1-82976 |
|---|
| Price | |
|---|
| Order / More Info | G3BP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25893917, 26285647 |
|---|
| 产品资料 |
|
|