| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TAP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TAP1. This antibody reacts with human. The TAP1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEK |
|---|
| Other Names | ABC transporter, MHC 1, ABCB2FLJ41500, antigen peptide transporter 1, APT1, ATP-binding cassette sub-family B member 2, ATP-binding cassette, sub-family B (MDR/TAP), member 2, D6S114E, Peptide supply factor 1, Peptide transporter involved in antigen processing 1, Peptide transporter PSF1, Peptide transporter TAP1, PSF-1, PSF1ABC17, Really interesting new gene 4 protein, RING4FLJ26666, TAP1*0102N, TAP1N, transporter 1, ATP-binding cassette, sub-family B (MDR/TAP), transporter associated with antigen processing, transporter, ATP-binding cassette, major histocompatibility complex, 1, Y3 |
|---|
| Gene, Accession # | TAP1, Gene ID: 6890 |
|---|
| Catalog # | NBP2-55934 |
|---|
| Price | |
|---|
| Order / More Info | TAP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|