| Edit |   |
| Antigenic Specificity | SEC14L3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SEC14L3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SEC14L3. This antibody reacts with rat. The SEC14L3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the C terminal of Sec14l3. Immunizing peptide sequence RDQVKTQYEHSVQISRGSSHQVEYEILFPGCVLRWQFSSDGADIGFGVFL. |
| Other Names | SEC14-like protein 3, SEC14-like 3 (S. cerevisiae), TAP2 |
| Gene, Accession # | SEC14L3, Gene ID: 266629, Accession: Q9Z1J8 |
| Catalog # | NBP1-74169-20ul |
| Price | |
| Order / More Info | SEC14L3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |