| Edit |   |
| Antigenic Specificity | SEC14L4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SEC14L4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SEC14L4. This antibody reacts with human. The SEC14L4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SEC14L4(SEC14-like 4 (S. cerevisiae)) The peptide sequence was selected from the N terminal of SEC14L4. Peptide sequence MSSRVGDLSPQQQEALARFRENLQDLLPILPNADDYFLLRWLRARNFDLQ. |
| Other Names | dJ130H16.5, SEC14-like 4 (S. cerevisiae), SEC14p-like protein TAP3, TAP3SEC14-like protein 4, Tocopherol-associated protein 3 |
| Gene, Accession # | SEC14L4, Gene ID: 284904, Accession: Q9UDX3, SwissProt: Q9UDX3 |
| Catalog # | NBP1-57591-20ul |
| Price | |
| Order / More Info | SEC14L4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |