| Edit |   |
|---|
| Antigenic Specificity | Claudin 16 (CLDN16) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. Claudin-16, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. |
|---|
| Immunogen | Claudin 16 antibody was raised using the C terminal of CLDN16 corresponding to a region with amino acids FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA |
|---|
| Other Names | CLDN16|HOMG3|PCLN1|claudin-16|Pcln1 |
|---|
| Gene, Accession # | Gene ID: 10686 |
|---|
| Catalog # | ABIN634606 |
|---|
| Price | |
|---|
| Order / More Info | Claudin 16 (CLDN16) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|