| Edit |   |
|---|
| Antigenic Specificity | Claudin 18 (CLDN18) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CLDN18 belongs to the large claudin family of proteins, which form tight junction strands in epithelial cells. |
|---|
| Immunogen | Claudin 18 antibody was raised using the C terminal of CLDN18 corresponding to a region with amino acids PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE |
|---|
| Other Names | claudin-18|CLDN18|SFTA5|SFTPJ |
|---|
| Gene, Accession # | Gene ID: 51208 |
|---|
| Catalog # | ABIN635505 |
|---|
| Price | |
|---|
| Order / More Info | Claudin 18 (CLDN18) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|