| Edit |   |
|---|
| Antigenic Specificity | Claudin 7 (CLDN7) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells. |
|---|
| Immunogen | Claudin 7 antibody was raised using the C terminal of CLDN7 corresponding to a region with amino acids GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV |
|---|
| Other Names | cb388|claudin7|cldn7|wu:fd19f08|MGC53400|MGC75689|CLDN7|CEPTRL2|CLDN-7|CPETRL2|Hs.84359|claudin-1 |
|---|
| Gene, Accession # | Gene ID: 1366 |
|---|
| Catalog # | ABIN636051 |
|---|
| Price | |
|---|
| Order / More Info | Claudin 7 (CLDN7) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|