| Edit |   |
| Antigenic Specificity | TGF-alpha |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. IHC-P reported in scientific literature (PMID: 26279457). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TGF-alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to TGF-alpha. This antibody reacts with human. The TGF-alpha Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TGF-alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQ |
| Other Names | protransforming growth factor alpha, TFGA, transforming growth factor, alpha, transforming growth factor-alpha |
| Gene, Accession # | TGFA, Gene ID: 7039 |
| Catalog # | NBP1-87501 |
| Price | |
| Order / More Info | TGF-alpha Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 26279457 |