| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CPSF73 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CPSF73 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CPSF73. This antibody reacts with human, mouse, rat. The CPSF73 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat CPSF73 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQK |
|---|
| Other Names | cleavage and polyadenylation specific factor 3, 73kD subunit, cleavage and polyadenylation specific factor 3, 73kDa, cleavage and polyadenylation specificity factor 3, Cleavage and polyadenylation specificity factor 73 kDa subunit, cleavage and polyadenylation specificity factor subunit 3, CPSF 73 kDa subunit, CPSF-73, CPSF73CPSF, EC 3.1.27, EC 3.1.27.-, mRNA 3'-end-processing endonuclease CPSF-73, YSH1 |
|---|
| Gene, Accession # | CPSF3, Gene ID: 51692 |
|---|
| Catalog # | NBP1-85476 |
|---|
| Price | |
|---|
| Order / More Info | CPSF73 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|