| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | mediator of cell motility 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The mediator of cell motility 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to mediator of cell motility 1. This antibody reacts with human. The mediator of cell motility 1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MEMO1(mediator of cell motility 1) The peptide sequence was selected from the middle region of MEMO1. Peptide sequence AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH. |
|---|
| Other Names | C21orf19-like protein, C2orf4DKFZp434I0135, CGI-27, FLJ25031, HCV NS5A-transactivated protein 7, Hepatitis C virus NS5A-transactivated protein 7, mediator of cell motility 1, Mediator of ErbB2-driven cell motility 1, memo-1, MEMOchromosome 2 open reading frame 4, NS5ATP7, protein MEMO1 |
|---|
| Gene, Accession # | MEMO1, Gene ID: 51072, Accession: Q9Y316, SwissProt: Q9Y316 |
|---|
| Catalog # | NBP1-54373-20ul |
|---|
| Price | |
|---|
| Order / More Info | mediator of cell motility 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|