| Edit |   |
|---|
| Antigenic Specificity | MEF2B |
|---|
| Clone | 4B5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against tissue lysate and recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MEF2B Antibody (4B5) from Novus Biologicals is a mouse monoclonal antibody to MEF2B. This antibody reacts with human. The MEF2B Antibody (4B5) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | MEF2B (NP_005910.1 165 a.a. - 235 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP |
|---|
| Other Names | LOC729991-MEF2B readthrough transcript, MEF2B, myocyte enhancer factor 2B |
|---|
| Gene, Accession # | MEF2BNB-MEF2B, Gene ID: 4207, Accession: NP_005910, SwissProt: NP_005910 |
|---|
| Catalog # | H00004207-M24 |
|---|
| Price | |
|---|
| Order / More Info | MEF2B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|