| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FACA/FANCA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FACA/FANCA Antibody from Novus Biologicals is a rabbit polyclonal antibody to FACA/FANCA. This antibody reacts with human. The FACA/FANCA Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human FACA/FANCA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LQALTSGWSVAASLQRQRELLMYKRILLRLPSSVLCGSSFQAEQPITARCEQFFHLVNSEMRNFCSHGGALTQDITAHFF |
|---|
| Other Names | FA, FA1, FAAMGC75158, FACAFanconi anemia group A protein, FAH, FA-H, FANCH, Fanconi anemia, complementation group A, Fanconi anemia, complementation group H, Fanconi anemia, type 1, Protein FACA |
|---|
| Gene, Accession # | FANCA, Gene ID: 2175 |
|---|
| Catalog # | NBP2-56898 |
|---|
| Price | |
|---|
| Order / More Info | FACA/FANCA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|