| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TNFAIP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TNFAIP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TNFAIP2. This antibody reacts with human. The TNFAIP2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TNFAIP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RWAEDVPPQRLDGHCHSELAIDIIQITSQAQAKAESITLDLGSQIKRVLLVELPAFLRSYQRAFNEFLERGKQLTNYRANVIANINNCLSFRMSMEQNWQVPQDTLSLLLGPLGELKSH |
|---|
| Other Names | B94, EXOC3L3, exocyst complex component 3-like 3, Primary response gene B94 protein, TNF alpha-induced protein 2, tumor necrosis factor alpha-induced protein 2, tumor necrosis factor, alpha-induced protein 2 |
|---|
| Gene, Accession # | TNFAIP2, Gene ID: 7127 |
|---|
| Catalog # | NBP2-55173 |
|---|
| Price | |
|---|
| Order / More Info | TNFAIP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|