| 产品详情 |
| Edit |   |
| Antigenic Specificity | TNFAIP8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TNFAIP8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TNFAIP8. This antibody reacts with human. The TNFAIP8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TNFAIP8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI |
| Other Names | GG2-1, Head and neck tumor and metastasis-related protein, MDC-3.13TNF-induced protein GG2-1, NDED, NF-kappa-B-inducible DED-containing protein, SCC-S2SCCS2, TNF alpha-induced protein 8, tumor necrosis factor alpha-induced protein 8, tumor necrosis factor, alpha-induced protein 8 |
| Gene, Accession # | TNFAIP8, Gene ID: 25816, Accession: O95379, SwissProt: O95379 |
| Catalog # | NBP2-33814 |
| Price | |
| Order / More Info | TNFAIP8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|