| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SIAE |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SIAE Antibody from Novus Biologicals is a rabbit polyclonal antibody to SIAE. This antibody reacts with human. The SIAE Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SIAE antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLN |
|---|
| Other Names | AIS6, CSEC, CSE-C, cytosolic sialic acid 9-O-acetylesterase homolog, EC 3.1.1.53, H-Lse, LSE, MGC87009, sialate O-acetylesterase, sialic acid acetylesterase, Sialic acid-specific 9-O-acetylesterase, sialic acid-specific acetylesterase II, YSG2, Ysg2 homolog (mouse) |
|---|
| Gene, Accession # | SIAE, Gene ID: 54414 |
|---|
| Catalog # | NBP1-84372 |
|---|
| Price | |
|---|
| Order / More Info | SIAE Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|