| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Sialin/SLC17A5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Sialin/SLC17A5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Sialin/SLC17A5. This antibody reacts with human. The Sialin/SLC17A5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC17A5(solute carrier family 17 (anion/sugar transporter), member 5) The peptide sequence was selected from the N terminal of SLC17A5. Peptide sequence LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS |
|---|
| Other Names | ASTSodium/sialic acid cotransporter, FLJ22227, FLJ23268, ISSD, Membrane glycoprotein HP59, NSD, SD, sialic acid storage disease, SIALIN, SIASD, SLDSolute carrier family 17 member 5, solute carrier family 17 (anion/sugar transporter), member 5, solute carrier family 17, member 5 |
|---|
| Gene, Accession # | SLC17A5, Gene ID: 26503, Accession: Q9NRA2, SwissProt: Q9NRA2 |
|---|
| Catalog # | NBP1-59788 |
|---|
| Price | |
|---|
| Order / More Info | Sialin/SLC17A5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|