| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SENP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SENP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SENP3. This antibody reacts with human. The SENP3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SENP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTL |
|---|
| Other Names | DKFZP586K0919, DKFZp762A152, EC 3.4.22, EC 3.4.22.-, sentrin/SUMO-specific protease 3, Sentrin/SUMO-specific protease SENP3, sentrin-specific protease 3, SMT3IP1, SSP3DKFZp586K0919, SUMO1/sentrin/SMT3 specific peptidase 3, SUMO1/sentrin/SMT3 specific protease 3, SUMO-1-specific protease 3, SUSP3 |
|---|
| Gene, Accession # | SENP3, Gene ID: 26168 |
|---|
| Catalog # | NBP2-32525 |
|---|
| Price | |
|---|
| Order / More Info | SENP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|