| Edit |   |
| Antigenic Specificity | PCDHAC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PCDHAC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCDHAC1. This antibody reacts with human. The PCDHAC1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PCDHAC1(protocadherin alpha subfamily C, 1) The peptide sequence was selected from the N terminal of PCDHAC1. Peptide sequence RVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLGPPE. |
| Other Names | PCDH-ALPHA-C1, protocadherin alpha subfamily C, 1, protocadherin alpha-C1 |
| Gene, Accession # | PCDHAC1, Gene ID: 56135, Accession: B2RNA7, SwissProt: B2RNA7 |
| Catalog # | NBP1-59214 |
| Price | |
| Order / More Info | PCDHAC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |