| Edit |   |
| Antigenic Specificity | ANKMY2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ANKMY2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKMY2. This antibody reacts with human. The ANKMY2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ANKMY2(ankyrin repeat and MYND domain containing 2) Antibody(against the N terminal of ANKMY2. Peptide sequence DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL. |
| Other Names | ankyrin repeat and MYND domain containing 2, ankyrin repeat and MYND domain-containing protein 2, DKFZP564O043, ZMYND20 |
| Gene, Accession # | ANKMY2, Gene ID: 57037, Accession: Q8IV38, SwissProt: Q8IV38 |
| Catalog # | NBP1-56599-20ul |
| Price | |
| Order / More Info | ANKMY2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |