| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ANKRD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANKRD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKRD1. This antibody reacts with human. The ANKRD1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ANKRD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RYKMIRLLIMYGADLNIKNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKT SRIATF |
|---|
| Other Names | ALRP, ankyrin repeat domain 1 (cardiac muscle), ankyrin repeat domain-containing protein 1, bA320F15.2, C193, C-193, Cardiac ankyrin repeat protein, CARPCytokine-inducible nuclear protein, CVARP, Cytokine-inducible gene C-193 protein, HA1A2, liver ankyrin repeat domain 1, MCARP |
|---|
| Gene, Accession # | ANKRD1, Gene ID: 27063, Accession: Q15327, SwissProt: Q15327 |
|---|
| Catalog # | NBP2-14292 |
|---|
| Price | |
|---|
| Order / More Info | ANKRD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|