Edit |   |
Antigenic Specificity | rho GTPase Activating Protein 36 (ARHGAP36) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | RP13-102H20.1 is the GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. |
Immunogen | RP13-102 H20.1 antibody was raised using the N terminal of RP13-102 20.1 corresponding to a region with amino acids VARHFLSEFKPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVL |
Other Names | 1100001E04Rik|rho-gap |
Gene, Accession # | Gene ID: 158763 |
Catalog # | ABIN636091 |
Price | |
Order / More Info | rho GTPase Activating Protein 36 (ARHGAP36) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |