| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Microsomal Glutathione S-transferase 1/MGST1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for Microsomal glutathione S-transferase 1(MGST1) detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. Microsomal glutathione S-transferase 1 is an enzyme that in humans is encoded by the MGST1 gene. The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human MGST1 (42-75aa KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids. |
|---|
| Other Names | Microsomal glutathione S-transferase 1;Microsomal GST-1;2.5.1.18;Microsomal GST-I;MGST1;GST12, MGST; |
|---|
| Gene, Accession # | MGST1, UniProt: P10620 |
|---|
| Catalog # | PB9723 |
|---|
| Price | |
|---|
| Order / More Info | Microsomal Glutathione S-transferase 1/MGST1 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|