| 产品详情 |
| Edit |   |
|---|
| Product Name | CD28, Fc Fusion, Recombinant, Human (T-Cell-Specific Surface Glycoprotein, TP44) |
|---|
| Description | Purity ~90%. Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Product Description: Human secreted CD28-Fc fusion protein (GenBank Accession No. NM_006139), aa 19-152, expressed in a HEK293 cell expression system. Molecular Weight: ~41.4kD (monomer). This protein runs at a higher molecular weight due to glycosylation. Amino Acid Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPDMDPKSCDKTHTCPPCP APELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS VMHEALHNHYTQKSLSLSPGK Note: NKIL. PSKP: CD28 (aa 19-152) DMD: Linker amino acids PKSC.SPGK: Fc of human IgG1 (aa 100-330) Applications: Suitable for use in studies of protein-protein interaction and in in vitro and in vivo protein fun |
|---|
| Size | 200ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | T-Cell-Specific Surface Glycoprotein, TP44 |
|---|
| Gene, Accession, CAS # | Accession: NM_006139 |
|---|
| Catalog # | 172324 |
|---|
| Price | |
|---|
| Order / More Info | CD28, Fc Fusion, Recombinant, Human (T-Cell-Specific Surface Glycoprotein, TP44) from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|