| 产品详情 |
| Edit |   |
|---|
| Product Name | CD47, Fc, Recombinant, Human, aa19-139 |
|---|
| Description | Highly Purified (~90%). This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010]. Source: Recombinant Fc fusion protein corresponding to aa19-139 from human CD47 at C-terminal, expressed in a HEK293 cell expression system. Molecular Weight: ~40kD, runs at a higher MW by SDS-PAGE due to glycosylation AA Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKST VPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVS WFSPIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | CD47, Fc, Recombinant, Human, aa19-139 (Leukocyte Surface Antigen CD47, Rh-Related Antigen, Integrin-Associated Protein, Antigenic Surface Determinant Protein OA3, Antigen Identified by Monoclonal Antibody 1D8, IAP, MER6) |
|---|
| Gene, Accession, CAS # | Accession: NM_001777, SwissProt: Q08772 |
|---|
| Catalog # | 298393 |
|---|
| Price | |
|---|
| Order / More Info | CD47, Fc, Recombinant, Human, aa19-139 from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|