| Edit |   |
| Antigenic Specificity | TSPYL4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TSPYL4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSPYL4. This antibody reacts with human. The TSPYL4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TSPYL4(TSPY-like 4) The peptide sequence was selected from the middle region of TSPYL4. Peptide sequence QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE. |
| Other Names | KIAA0721dJ486I3.2, testis-specific Y-encoded-like protein 4, TSPY-like 4, TSPY-like protein 4 |
| Gene, Accession # | TSPYL4, Gene ID: 23270, Accession: Q9UJ04, SwissProt: Q9UJ04 |
| Catalog # | NBP1-56289-20ul |
| Price | |
| Order / More Info | TSPYL4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |