| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AMHR2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-AMHR2 Antibody. Reactivity: Human, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human AMHR2 (384-419aa QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE), different from the related mouse and rat sequences by three amino acids. |
|---|
| Other Names | Muellerian hormone type-2 receptor isoform 2; Muellerian hormone type-2 receptor; Muellerian hormone type-2 receptor; Mullerian hormone receptor type 2; Muellerian hormone type II receptor; AMH type II receptor; MIS type II receptor; MISRII; MRII, AMHR2; AMHR2; AMHR; MRII; MISR2; MISRII; AMHR; MISR2; AMH type II receptor; MISRII; MRII |
|---|
| Gene, Accession # | AMHR2, Gene ID: 269, NCBI: NP_001158162.1, UniProt: Q16671 |
|---|
| Catalog # | MBS178484 |
|---|
| Price | |
|---|
| Order / More Info | AMHR2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Behringer RR (1994). The in vivo roles of mullerian-inhibiting substance. Current Topics in Developmental Biology. Current Topics in Developmental Biology 29: 171-87. 2. Cate RL, Mattaliano RJ, Hession C, Tizard R, Farber NM, Cheung A, Ninfa EG, Frey AZ, Gash DJ, Chow EP (Jun 1986). Isolation of the bovine and human genes for Mullerian inhibiting substance and expression of the human gene in animal cells. Cell 45 (5): 685-98. |
|---|
| 产品资料 |
|
|