| 产品详情 |
| Edit |   |
| Antigenic Specificity | glycerol-3-phosphate permease |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The glycerol-3-phosphate permease Antibody from Novus Biologicals is a rabbit polyclonal antibody to glycerol-3-phosphate permease. This antibody reacts with human. The glycerol-3-phosphate permease Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human glycerol-3-phosphate permease antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IVKGELHKYCTAWDEADVRFSSQNRKSGSAAPHQLPDNETDCGWAPFDKNNY |
| Other Names | FLJ22340, G-3-P permease, G-3-P transporter, G3PPgene similar to glycerol-3-phosphate permease10Glycerol-3-phosphate permease, glycerol-3-phosphate transporter, solute carrier family 37 (glycerol-3-phosphate transporter), member 1, Solute carrier family 37 member 1 |
| Gene, Accession # | SLC37A1, Gene ID: 54020 |
| Catalog # | NBP1-87524 |
| Price | |
| Order / More Info | glycerol-3-phosphate permease Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|