| Edit |   |
|---|
| Antigenic Specificity | Melanoma Antigen Family A, 3 (MAGEA3) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MAGEA3 is a member of the MAGEA family. The members of this family have 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. |
|---|
| Immunogen | MAGEA3 antibody was raised using the middle region of MAGEA3 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD |
|---|
| Other Names | Mage-a3|MAGEA3|CT1.3|HIP8|HYPD|MAGE3|MAGEA6 |
|---|
| Gene, Accession # | Gene ID: 4102 |
|---|
| Catalog # | ABIN631907 |
|---|
| Price | |
|---|
| Order / More Info | Melanoma Antigen Family A, 3 (MAGEA3) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|