| Edit |   |
|---|
| Antigenic Specificity | MAGEA10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 43%, rat 43%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human MAGEA10 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTST |
|---|
| Other Names | melanoma antigen family A10, CT1.10, MAGE10, MGC10599 |
|---|
| Gene, Accession # | Gene ID: 4109, UniProt: P43363, ENSG00000124260 |
|---|
| Catalog # | HPA070780 |
|---|
| Price | |
|---|
| Order / More Info | MAGEA10 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|