Edit |   |
Antigenic Specificity | Melanoma Antigen Family B, 1 (MAGEB1) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. |
Immunogen | MAGEB1 antibody was raised using the middle region of MAGEB1 corresponding to a region with amino acids QEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLAKMNGATPRDF |
Other Names | MAGEB1|MAGEB4|CT3.1|DAM10|MAGE-Xp|MAGEL1|Mageb1|RGD1560904|Mage-b1|Mage-rs1|Magel1|Smage1|dam1 |
Gene, Accession # | Gene ID: 4112 |
Catalog # | ABIN632954 |
Price | |
Order / More Info | Melanoma Antigen Family B, 1 (MAGEB1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |