| Edit |   |
|---|
| Antigenic Specificity | Melanoma Antigen Family B, 3 (MAGEB3) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognised on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos |
|---|
| Immunogen | MAGEB3 antibody was raised using the N terminal of MAGEB3 corresponding to a region with amino acids MPRGQKSTLHAREKRQQTRGQTQDHQGAQITATNKKKVSFSSPLILGATI |
|---|
| Other Names | CT3.5|Smage3|Mage-b3|Mage-ps1|Mage-rs3|RGD1562343|Mageb3|EG436212|MAGEB3 |
|---|
| Gene, Accession # | Gene ID: 4114 |
|---|
| Catalog # | ABIN632466 |
|---|
| Price | |
|---|
| Order / More Info | Melanoma Antigen Family B, 3 (MAGEB3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|