Edit |   |
Antigenic Specificity | BAD |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 86%, rat 88%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human BAD polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR |
Other Names | BCL2-associated agonist of cell death, BBC2, BCL2L8 |
Gene, Accession # | Gene ID: 572, UniProt: Q92934, ENSG00000002330 |
Catalog # | HPA062105 |
Price | |
Order / More Info | BAD Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |