| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADRA1A, aa335-373 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse, human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | n/a |
|---|
| Concentration | n/a |
|---|
| Applications | WB (0.1 - 0.5 µg/ml) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ADRA1A Antibody (aa335-373) LS-C407964. Specificity: Expressed in heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Within the prostate, expressed in the apex, base, periurethral and lateral lobe. Isoform 4 is the most abundant isoform expressed in the prostate with high levels also detected in liver and heart. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ADRA1A (335-373aa KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD), different from the related mouse and rat sequences by four amino acids. |
|---|
| Other Names | ADRA1A, ADRA1L1, Adrenergic alpha 1c receptor, Alpha 1c adrenoceptor, Alpha-adrenergic receptor 1c, ADRA1C, Adrenoceptor alpha 1A, Alpha-1A adrenoceptor, Alpha-1A adrenoreceptor, Alpha-1A adrenergic receptor, Alpha-1C adrenergic receptor, ALPHA1AAR, Alpha1C-AR |
|---|
| Gene, Accession # | ADRA1A, Gene ID: 148 |
|---|
| Catalog # | LS-C407964 |
|---|
| Price | |
|---|
| Order / More Info | ADRA1A, aa335-373 Antibody from LIFESPAN BIOSCIENCES INC. |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|