| 产品详情 |
| Edit |   |
|---|
| Product Name | PCGF6, Recombinant, Human, aa2-350, GST-tag |
|---|
| Description | Purified (~86%). Transcriptional repressor that modulates the levels of histone H3K4Me3 by activating KDM5D histone demethylase. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A Lys-119, rendering chromatin heritably changed in its expressibility. Source: Recombinant protein corresponding to aa2-350 from human PCGF6, fused to GST-tag at N-terminal, expressed in Sf9 insect cells. Molecular Weight: ~65.7kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFKDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDPLVPRGSPGEFEGVA VVTAGSVGAAKTEGAAALPPPPPVSPPALTPAPAAGEEGPAPLSETGAPGCSGSRPPE LEP |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | PCGF6, Recombinant, Human, aa2-350, GST-tag (Polycomb Group RING Finger Protein 6, Mel18 And Bmi1-Like RING Finger Protein, MBLR, RNF134) |
|---|
| Gene, Accession, CAS # | Accession: NM_001011663.1, SwissProt: Q9BYE7 |
|---|
| Catalog # | 298443 |
|---|
| Price | |
|---|
| Order / More Info | PCGF6, Recombinant, Human, aa2-350, GST-tag from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|