| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CCT3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-CCT3 Antibody. Reactivity: Human, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid. |
|---|
| Other Names | T-complex protein 1 subunit gamma isoform c; T-complex protein 1 subunit gamma; T-complex protein 1 subunit gamma; chaperonin containing TCP1 subunit 3; CCT-gamma; hTRiC5, CCT3; CCT3; CCTG; PIG48; TRIC5; CCT-gamma; TCP-1-gamma; CCTG; TRIC5; TCP-1-gamma |
|---|
| Gene, Accession # | CCT3, Gene ID: 7203, NCBI: NP_001008800.1, UniProt: P49368 |
|---|
| Catalog # | MBS178426 |
|---|
| Price | |
|---|
| Order / More Info | CCT3 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: CCT3 chaperonin containing TCP1, subunit 3 (gamma). 2. Joly EC, Sevigny G, Todorov IT, Bibor-Hardy V (Mar 1994). cDNA encoding a novel TCP1-related protein.Biochimica et Biophysica Acta 1217 (2): 224-6. 3. Walkley NA, Demaine AG, Malik AN (Jan 1996).Cloning, structure and mRNA expression of human Cctg, which encodes the chaperonin subunit CCT gamma. The Biochemical Journal 313 (Pt 2): 381-9. |
|---|
| 产品资料 |
|
|