| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Angiotensin II Receptor, Type 1 (AGTR1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, dog |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. AGTR1 is the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. |
|---|
| Immunogen | AGTR1 antibody was raised using the N terminal of AGTR1 corresponding to a region with amino acids ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI |
|---|
| Other Names | AGTR1B|AT1|XAT-1|agtr1-A|agtr1.2|at2|AGTR2|zgc:113016|at2r|atgr2|mrx88|AG2S|AGTR1A|AT1AR|AT1B|AT1BR|AT1R|AT2R1|AT2R1A|AT2R1B|HAT1R|at1|AT1-R|1810074K20Rik|AI551199|AT1a|Agtr-1a|Agtr1|Angtr-1a|AT3|AT1R|Agtr-1b|Angtr-1b|AGTR1 |
|---|
| Gene, Accession # | Gene ID: 185,403836,11607,81638 |
|---|
| Catalog # | ABIN634511 |
|---|
| Price | |
|---|
| Order / More Info | Angiotensin II Receptor, Type 1 (AGTR1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|