Edit |   |
Antigenic Specificity | Steroid 5 alpha-Reductase 3 (SRD5A3) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | SRD5A3 belongs to the steroid 5-alpha reductase family and converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT). |
Immunogen | SRD5 A3 antibody was raised using the N terminal of SRD5 3 corresponding to a region with amino acids GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWN |
Other Names | CDG1P|CDG1Q|KRIZI|SRD5A2L|SRD5A2L1|1110025P14Rik|A430076C09|AV364670|AW987574|D730040M03Rik|H5ar|S5AR 3|Srd5a2l|RGD1308828|SRD5alpha3 |
Gene, Accession # | Gene ID: 79644,57357,305291 |
Catalog # | ABIN636011 |
Price | |
Order / More Info | Steroid 5 alpha-Reductase 3 (SRD5A3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |