| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AIF |
|---|
| Clone | 2I5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG1 |
|---|
| Format | unconjugated |
|---|
| Size | 100ug |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | Flow Cytometry, IF, IHC-P, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Mouse IgG monoclonal Picoband™ antibody for AIF detection. Tested with WB, IHC-P, IF, FCM in Human;Mouse;Rat. No cross reactivity with other proteins. Apoptosis-inducing factor 1, mitochondrial, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene. AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences. |
|---|
| Other Names | Allograft inflammatory factor 1; AIF-1; Ionized calcium-binding adapter molecule 1; Protein G1; AIF1; G1; IBA1 |
|---|
| Gene, Accession # | AIF1, UniProt: P55008 |
|---|
| Catalog # | M01571-1 |
|---|
| Price | |
|---|
| Order / More Info | AIF Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|