| 产品详情 |
| Edit |   |
|---|
| Product Name | CXCL5, Recombinant, Human, 8-78aa |
|---|
| Description | Purity ≥98% by SDS-PAGE gel and HPLC analyses. ENA-78 is a CXC chemokine that signals through the CXCR2 receptor. It is expressed in monocytes, platelets, endothelial cells, and mast cells. ENA-78 is a chemoattractant for neutrophils. Three N-terminal truncated variants of human ENA-78, ENA 5-78, ENA 8-78, ENA 9-78, contain 74, 71, and 70aa residues, respectively, possess increased biological activity. ENA-78 contains the four conserved cysteine residues present in CXC chemokines, and also contains the lsquoELRrsquo motif common to CXC chemokine that bind to the CXCR1 and CXCR2 receptors. Recombinant human ENA-78 is a 7.8kD protein consisting of 71aa residues. Biological Activity: Determined by its ability to chemoattract human neutrophils using a concentration range of 10-100ng/ml. AA Sequence: LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN Quality Control: Verified by N-terminal and Mass Spectrometry analyses (when applicable). Endotoxin: <0.1ng/ug of protein |
|---|
| Size | 5ug, 20ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | CXCL5, Recombinant, Human, 8-78aa (C-X-C Motif Chemokine 5, ENA-78 (1-78), Epithelial-derived Neutrophil-activating Protein 78, Neutrophil-activating Peptide ENA-78, Small-inducible Cytokine B5, ENA78, SCYB5) |
|---|
| Gene, Accession, CAS # | n/a |
|---|
| Catalog # | 143313 |
|---|
| Price | |
|---|
| Order / More Info | CXCL5, Recombinant, Human, 8-78aa from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|