| Edit |   |
|---|
| Antigenic Specificity | VPS26B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 96%, rat 96%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human VPS26B polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RRYFKQQEVVLWRKGDIVRKSMSHQAAIASQRFEGTTSLGEVRTPSQLSDNNCRQ |
|---|
| Other Names | vacuolar protein sorting 26 homolog B (S. pombe), MGC10485, Pep8b |
|---|
| Gene, Accession # | Gene ID: 112936, UniProt: Q4G0F5, ENSG00000151502 |
|---|
| Catalog # | HPA038172 |
|---|
| Price | |
|---|
| Order / More Info | VPS26B Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|