| Edit |   |
|---|
| Antigenic Specificity | Dishevelled 2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Dishevelled 2 Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Dishevelled 2 (35-64aa AERITLGDFKSVLQRPAGAKYFFKSMDQDF), identical to the related mouse sequence.Subcellular Localization: Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytosol. Cytoplasmic vesicle. |
|---|
| Other Names | segment polarity protein dishevelled homolog DVL-2; Segment polarity protein dishevelled homolog DVL-2; segment polarity protein dishevelled homolog DVL-2; dishevelled segment polarity protein 2; DSH homolog 2, DVL2; DVL2; Dishevelled-2 |
|---|
| Gene, Accession # | DVL2, Gene ID: 1856, NCBI: NP_004413.1, UniProt: O14641 |
|---|
| Catalog # | MBS1750766 |
|---|
| Price | |
|---|
| Order / More Info | Dishevelled 2 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|