| Edit |   |
|---|
| Antigenic Specificity | Dishevelled 3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Dishevelled 3 Picoband Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L), identical to the related mouse sequence.Subcellular Localization: Cytoplasm. |
|---|
| Other Names | segment polarity protein dishevelled homolog DVL-3; Segment polarity protein dishevelled homolog DVL-3; segment polarity protein dishevelled homolog DVL-3; dishevelled segment polarity protein 3; DSH homolog 3, DVL3; DVL3; DRS3; KIAA0208; Dishevelled-3 |
|---|
| Gene, Accession # | DVL3, Gene ID: 1857, NCBI: NP_004414.3, UniProt: Q92997 |
|---|
| Catalog # | MBS1750845 |
|---|
| Price | |
|---|
| Order / More Info | Dishevelled 3 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|